DPCstruct | MC43623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 85 ± 5 aa |
| Standard deviation of domain lengths | 4.87 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 49.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K2T0W1 | 34-117 | QPISADGKGGPLLGGTNKQVDLDNPSNLGAACTDSGVVPNLKWRFSDSHVKLSNGGWTREQVVTDLPLSRDIAAAQQHLRQGAI |
| A0A6A4I6E7 | 29-107 | PIPYRNGKGSTVLGPRNIERERQNPDMLRPPSTDHGTLPNMKWSFADSHTRIEEGGWARQTTVRELPTSIELAGVNMRL |
| A0A1R1QPK3 | 8-91 | None |
| A0A1Y6FVV5 | 13-103 | None |
| A0A1L9R9R6 | 72-153 | None |
| E2LI77 | 55-143 | None |
| A0A4Y9Z5U0 | 276-361 | None |
| A0A146ICL3 | 282-367 | None |
| A0A5C6SCU7 | 66-149 | None |
| A0A6L7EFQ7 | 10-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.