DPCstruct | MC4362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 129 |
|---|---|
| Mean domain length (aa) | 185 ± 34 aa |
| Standard deviation of domain lengths | 33.97 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.62 |
| Pfam Score | 77.95 |
| Assigned Pfam label(s) | CL0745- CL0692- CL0027- CL0001- CL0422 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9FRY1 | 57-261 | IVPTSCETLARLGVTRSGTYLVDPDGVLRGDQPIQVFCDMVTDTASTYVLHNSMEATEIYHCPDPGCYARRVTYDASIKQMQALIDQ… |
| A0A7J8ECR6 | 9-166 | DGTYWVDPNLGCSSDTIEVSCNFTHGGQTCLKPITASKVEFAVSRVQMNFLHLLSSEVTQHITIHCLNMTVWQEGSGHTPAKQAVRF… |
| A0A7R8X513 | 123-278 | None |
| A0A7R8XGD8 | 88-291 | None |
| A0A7R8XL22 | 140-352 | None |
| A0A7R8XLS3 | 4-162 | None |
| A0A7R9A696 | 1-158 | None |
| A0A2H2JLS1 | 1-141 | None |
| A0A816A502 | 3-158 | None |
| A0A1S3JCN3 | 82-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.