DPCstruct | MC43617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 117 ± 21 aa |
| Standard deviation of domain lengths | 20.78 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0630 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803JEE6 | 250-403 | TTTTSTECSMSPGARVDCGYSGVSESQCRNKSCCFDSSIPNVKWCFYTQSQVADCKAVPPGQRTECGSPGISADQCRKLNCCFDSSI… |
| A0A1L8H5E1 | 1-92 | CAVAPADRVDCGYPTITEADCKAKSCCFDSSIINVIWCFYTASEGPLKKLECSGDPYKRKDCGFPGITEKQCKQNGCCFDPSIVGVK… |
| A0A0G4HWR5 | 319-451 | None |
| L5K8R6 | 48-194 | None |
| A0A2G8LEG2 | 1-124 | None |
| A0A7S4QYM7 | 158-283 | None |
| A0A6P8RBN0 | 89-243 | None |
| A0A2B4SIZ7 | 15-161 | None |
| A0A2B4SEF9 | 660-796 | None |
| A0A7M5XCA9 | 16-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.