DPCstruct | MC43615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 252 ± 55 aa |
| Standard deviation of domain lengths | 54.87 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 75.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 20.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0133 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N2L1F9 | 85-359 | SLHHFRSKSFPTRAHPLISEFNEQLSRVRGSETTSSSSTSLSQKLIGLRGLHDCVENLLLLPCTQALAQEQHQKWFNELLDGSLRLL… |
| A0A426ZJY4 | 161-479 | VLISSKLSPSPVAPWPPVRTPFDRWIAAELEELRFPAFSRKTSAQWLSKALDLAVAALEMMARSVALAGPRLGATNRKLVEDYLEDV… |
| A0A4Y7JAZ0 | 2-174 | None |
| A0A6A6L1Q0 | 2-185 | None |
| A0A2U1QEY7 | 279-555 | None |
| A0A445I070 | 8-272 | None |
| A0A0D3DQ92 | 15-377 | None |
| A0A4Y7J7K7 | 2-254 | None |
| A0A835R654 | 9-312 | None |
| A0A835RH58 | 1-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.