DPCstruct | MC43613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 4.72 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 60.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1D605 | 35-99 | EDLSTKAKSRFSVSLRSLSQPMSLKDIAKTWDVCARAVICEYAQQSGGGTFSSKYGSWENCSTAA |
| A0A7N2KPP8 | 1-76 | MVHLLNWLEDHEDLSVKVKSRLKVSLRSLLKPWSLGEIAMTWDFCVRAVISEHAQQNGGGNFSLKFGTWENFLSVA |
| A0A2N9GK05 | 768-834 | None |
| A0A453RSV0 | 1-67 | None |
| A0A6J1CCM7 | 296-357 | None |
| A0A2P2MQK9 | 216-275 | None |
| A0A5N5FUD2 | 803-865 | None |
| A0A6P8BS42 | 56-129 | None |
| A0A7J6VEH8 | 88-154 | None |
| A0A1D6KLU1 | 461-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.