DPCstruct | MC43612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 165 ± 25 aa |
| Standard deviation of domain lengths | 24.67 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 57.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05996 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N2KMQ6 | 1-155 | MQLLPWGGKLTSESLKFFSPIVLWTRFSPSQDRFDILYSAFMDYYKAWFELIKPAVGETDASQIMSNREAQHRYLTWRAEKDPGHGM… |
| A9RF24 | 233-400 | KYYSRILPLGNKYAELLPWGDKLTAESIQFFSPIVLWTRPASREEIQETVFRAFKDYLDAWLDMADKANPSNDAYEIAENQESHHRY… |
| A0A6P3Z8R1 | 1-117 | None |
| A0A2I0JNC7 | 54-218 | None |
| A0A7C8YV50 | 42-215 | None |
| A0A314YNB4 | 104-294 | None |
| D8R136 | 156-323 | None |
| Q5JKX7 | 1-181 | None |
| A0A0E0JTL7 | 345-544 | None |
| A0A5D2A3I6 | 65-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.