DPCstruct | MC43600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 5.43 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 57.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q1C3P4 | 5-74 | CVLGTSDTVFLWVQNPRPALEGHVFCSPVDQEAFMALLCFKNGSLTREHISNECAGGSWEVFSAMLRETP |
| A0A068UI37 | 1-59 | MANNSTAQMVFDINAEHNPSLEGHVFPNPVDASGYMVMLWYKNGSLTREYIRNRCAEKS |
| A0A0S7HD02 | 78-148 | None |
| A0A287ISQ7 | 50-109 | None |
| A0A5N5HSZ0 | 232-289 | None |
| A0A226N704 | 242-311 | None |
| A0A061I7V5 | 250-320 | None |
| A0A445K709 | 236-302 | None |
| A0A7R9FAY2 | 592-661 | None |
| A0A287ISS1 | 81-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.