DPCstruct | MC436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 59 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3YYE4 | 1-52 | MLEPGMLVTNPDAPDWGTGQVQSNINGRITVNFREAGKVVLDGGRVMLIPVV |
| A0A520NF53 | 1-54 | MLYFTLGDFVVHPDQPDWGPGQVQSIVGMNVTVNFPNAGKQLINCTHVELVKTN |
| A0A2G6IHA4 | 7-57 | None |
| D1KDW3 | 3-73 | None |
| A0A1G0IEZ5 | 126-201 | None |
| A0A495VEK9 | 2-55 | None |
| A0A1H0L8F9 | 8-60 | None |
| A0A2N6FAE4 | 43-100 | None |
| A0A399I1H1 | 2-55 | None |
| A0A1M6LSV7 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.