DPCstruct | MC43597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 63 ± 10 aa |
| Standard deviation of domain lengths | 9.56 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 94.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 43.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378A8S9 | 210-275 | KEKAGLERQVIAINNCRSVTKRDLVRNSATPHIEVDPETFAVKVDGEHATCNPVTTAVMNQKYFFG |
| A0A0P8X1H5 | 14-67 | VKGCRDVQKSDLIHNDYLPNIDVDPQTYQVKADGVLLWCEPAETLPMAQRYFLF |
| A0A7C5FIL5 | 95-160 | None |
| A0A6A5LA80 | 495-569 | None |
| A0A812KFW4 | 161-235 | None |
| A0A263HEL9 | 458-532 | None |
| A0A453MA98 | 10-75 | None |
| A0A7W1K1Q3 | 38-103 | None |
| A0A7W0YW41 | 89-142 | None |
| A0A2S8BN09 | 1-54 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.