DPCstruct | MC43595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 4.84 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 34.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377K5V0 | 95-179 | VPYAAVPNMLQPGVSKYDFAAGRSHIEGASKQSDFVQAGHQYGFNNLLTLYGGSMVANNYYAFTLGTGWNTRIGAISVDATKSHS |
| A0A378AWK9 | 1-101 | MVPFASLAILQREGQLDYALSSGRTRSGSSDDKEYNFIQSSLAYGATSNITLYTGFQQAEDKYTNLLLGAGFNLGTIGALSFDGSQS… |
| A0A7I6ZI83 | 354-444 | None |
| A0A378ANJ0 | 72-163 | None |
| A0A4Q2HQQ4 | 65-153 | None |
| A0A377LNY9 | 258-347 | None |
| A0A2X2C3T8 | 79-164 | None |
| A0A378B510 | 1-98 | None |
| A0A8B3HMW8 | 32-125 | None |
| I4KFC2 | 80-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.