DPCstruct | MC4359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 108 ± 14 aa |
| Standard deviation of domain lengths | 13.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 56.51 |
| Pfam Score | 85.21 |
| Assigned Pfam label(s) | PF16835- CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2XJI1 | 286-385 | TDRQNRVGSKFGGGGVSSGQNSERDRKERLRELALESVDLAKDPYLMRNHLGTYECKLCLTLHTNEGNYLAHTQGKKHQSGLAKRAL… |
| A0A1I8JA33 | 1-108 | MDFQHRPGGKTGTGGVASWSDSNRDRRERLRQLALETIDLQKDPYFMKNHLGTYECKLCLTLHNNEGSYLAHTQGKKHQQNLARRAA… |
| A0A067CJZ5 | 1-104 | None |
| A0A218WRP5 | 3-108 | None |
| A0A177SZA4 | 1-141 | None |
| A0A7R9L7M8 | 1-108 | None |
| A0A1L0G9G2 | 1-126 | None |
| A0A820ZCT3 | 3-111 | None |
| A0A401S4E3 | 3-111 | None |
| A0A7S2EFW9 | 138-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.