DPCstruct | MC43584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 103 ± 8 aa |
| Standard deviation of domain lengths | 7.55 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 55.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378BR34 | 2-103 | ISDLGGPTANMYMLRCKSPRAEQTCRRLSCVYPDICPHMDTNHEPTINLYRRARELKGIKKILIASGVRYDIAVEDPRYIKELATHH… |
| D3HW00 | 205-317 | MPDFKGYLSDLGGPSANMYGMAGRNRKACEHCKRPSCINPQICPNLDTDHTALLDIYRAVDRLPGIKKSFIGSGVRYDLLLYKGKDE… |
| A0A357XUJ5 | 126-225 | None |
| A0A838ZY52 | 1-93 | None |
| A0A379VLR1 | 1-89 | None |
| A0A2S5TP34 | 31-139 | None |
| A0A645CEA4 | 1-96 | None |
| A0A1Y0FZB2 | 468-576 | None |
| A0A7V1K4U5 | 1-97 | None |
| A0A844VV79 | 67-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.