DPCstruct | MC4358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 142 ± 26 aa |
| Standard deviation of domain lengths | 26.26 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 19.40 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | PF18453- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2ZWT6 | 1-110 | CTGLQPPRYGLFYVEKGSGISVGSMVVFWCKDGYQLVGSETLACLHGDSAPQWSSQPPLCEAIPKPVDKGFRVAVIASIISCIIILS… |
| A0A7J8D1V1 | 20-164 | HGLSAPENGACSPEKRLHPAGATVHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRAASLEGFYNGRSLDVAKAPAASSTLDAAH… |
| A0A834DCQ0 | 7-120 | None |
| A0A8B6EU12 | 20-140 | None |
| A0A3P7E6D1 | 120-280 | None |
| A0A803JU02 | 54-204 | None |
| A0A1S3J6W0 | 1-195 | None |
| K1Q2I0 | 1-163 | None |
| A0A3B4AJP2 | 1-128 | None |
| A0A0K0DSX8 | 1639-1855 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.