DPCstruct | MC43577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 109 ± 10 aa |
| Standard deviation of domain lengths | 9.77 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5YK26 | 150-266 | GVNVNRFKLAQQAASDIVDALNSGKKPRIYRNVSVLEVQQDFLENEADGLYVLGLDYHVGFLLKRSDSLYFIHADYFSGAVAAELFE… |
| A0A2N3HSW1 | 15-116 | QSASEVFISKLAERKDIKRFSNRPVSEIRKYLLFAGRGIYLVGLDQHVGFVLVDSNKMSFIHPSYYYPEKGVMSETLNSENPFKHSK… |
| A0A3C1W2T2 | 78-197 | None |
| I4ALQ1 | 131-239 | None |
| A0A7Y4TSA2 | 121-222 | None |
| A0A519LGK8 | 1-86 | None |
| A0A7D5S6J1 | 56-172 | None |
| A0A5B8V9F9 | 4-107 | None |
| A0A2H0AIY8 | 45-143 | None |
| A0A6I6GML5 | 79-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.