DPCstruct | MC4357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 190 |
|---|---|
| Mean domain length (aa) | 264 ± 53 aa |
| Standard deviation of domain lengths | 53.34 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.93 |
| Pfam Score | 77.50 |
| Assigned Pfam label(s) | PF04560- PF21091- PF04997- PF04998- PF00177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832X431 | 1-181 | ISINEVGVPDFVASELTVPEKVTAHNLEEMKTIVRNGPNTHPGANYVIRNDGRRKKITDTTKDDVAEELDVGFTVERQLRDGDIVLF… |
| A0A7J8D1L4 | 257-550 | PLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRL… |
| A0A4Y7L9T1 | 141-427 | None |
| A0A1A9X8V1 | 11-252 | None |
| A0A5S6Q651 | 207-523 | None |
| A0A7C6Y895 | 361-687 | None |
| A0A7S0MHA2 | 82-388 | None |
| A0A446JE33 | 2-197 | None |
| A0A4Z2HLZ3 | 252-582 | None |
| P14248 | 277-572 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.