DPCstruct | MC43565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 159 ± 20 aa |
| Standard deviation of domain lengths | 19.52 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8LF38 | 73-228 | IVENVEIHQNDSRLLQRSTLQILEFASKKEIPINCLNLNKSFKECEESNIVLHSGLTLTYLSTLENMQIDMEKDGERQEPKSLSEEE… |
| A0A2G8LFB4 | 418-563 | LESGKWRKPDDTQTIAVMCSNSWIINRTTSESVQRSVIELLVKASNHDIPIYWVDLTCSFSKIDEDGSIILSSGLSLPIITSIENMV… |
| A0A2G8L2Y7 | 5-158 | None |
| A0A2G8L1K3 | 5-124 | None |
| A0A2G8L092 | 110-277 | None |
| A0A2G8L084 | 148-344 | None |
| A0A2G8K4S0 | 559-716 | None |
| A0A2G8K4I8 | 174-345 | None |
| A0A2G8K2S4 | 76-215 | None |
| A0A2G8K3F3 | 262-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.