DPCstruct | MC43561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 277 ± 54 aa |
| Standard deviation of domain lengths | 54.23 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.60 |
| Pfam Score | 97.32 |
| Assigned Pfam label(s) | PF03095- CL0097- CL0110- CL0135 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8LCA1 | 21-273 | TWKKSQAYSDYMGFVRLMNTTVKGKKLTDECNVSETCQKLITMIDTLDGWAEEIPPLQQPQRYGNQAFRTWHTKLKEKGSVTTPGLI… |
| A0A7E4V453 | 30-330 | YFVPKRHVFAIFDMAKWYRSEAYDKYLNFLHRINDSVIGVSNNANVEISDRVKSVIKLIDTLSSWTSDFPPVDMQEQRFGNKAYRLW… |
| A0A654GHL3 | 7-227 | None |
| A0A4Y7QCZ9 | 2-263 | None |
| A0A0F7SWM6 | 9-372 | None |
| A0A4U5QLS4 | 414-720 | None |
| A0A2S5B9H5 | 23-365 | None |
| A0A2C5YJE7 | 2-182 | None |
| A0A507FNV0 | 16-340 | None |
| A0A507FIF5 | 53-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.