DPCstruct | MC43560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 483 ± 112 aa |
| Standard deviation of domain lengths | 112.44 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8LBF0 | 34-397 | YTEVSSIQMIFQGLQEEQDDLLSTDFSPRDSVTLISNVNNIYQAVLQEAWQVHESKALVYQSSDSSDLKLPAQLWTASSGPKGLRNL… |
| A0A4V6T715 | 2-679 | ARLVRGLWKSPVIKMEITKEVVAIKPTIDKKKLGAVQDELMKLSKFLEDNKTFIEGLSGPEGLNRVTSQQEDLALQGEHQALHSLQI… |
| A0A836APT1 | 10-581 | None |
| A0A5B8MR61 | 434-902 | None |
| A0A0D8XST2 | 459-907 | None |
| A0A7S1T985 | 541-950 | None |
| A0A1X2ICP2 | 5-317 | None |
| A0A1Y1WC94 | 1-654 | None |
| A0A1X2GLH9 | 2-499 | None |
| A0A2H1ZE14 | 426-958 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.