DPCstruct | MC4356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 169 ± 26 aa |
| Standard deviation of domain lengths | 25.87 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A365YTC0 | 513-671 | AAIAAVIAITRWHHARHHQQQEAAARQALTHLRAAYQHTAAAPLAAITAHAPHPRITAYWETRIHTLLPETADRITTDPTWPALATT… |
| A0A1C6QJQ9 | 2-160 | KNHAHQAEAARQTLHHLHTAADHALVPVIDNLAARQPSDQASRTLAHDVRAAVPDHADRILTDPAWPALATVLADAEAGGHKPHQLL… |
| A0A5Q4SPZ7 | 241-401 | None |
| A0A4Q8CVU5 | 39-256 | None |
| A0A2M8XJQ8 | 202-340 | None |
| A0A1Y2NCT1 | 151-337 | None |
| V6UL58 | 1-214 | None |
| A0A4R3BM31 | 4-142 | None |
| A0A117RFE4 | 154-299 | None |
| S5V6L6 | 90-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.