DPCstruct | MC43552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 232 ± 59 aa |
| Standard deviation of domain lengths | 59.15 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 77.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 37.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L5K164 | 1-165 | MTAQDEWVFADMDLLHKVVAPAIRMSLKLHQAQFTCPDEFEDPVVLYEAIQSFEKKVVICHEGDPAWRGAVLSNREELLTLRHVVDE… |
| A0A834CPF6 | 335-507 | PSYIYRVYCGDVPWTEGLDWLSSSKELYQLTLKAFRLSFKLLFDQASLGPMESYEELFSTLEDYERDWYIGLVTEKGWHDSVLQEKP… |
| A0A7J6PDT0 | 770-963 | None |
| A0A6J1WFX5 | 12-192 | None |
| A0A7R9KU42 | 468-648 | None |
| A0A672PTL8 | 640-838 | None |
| A0A177WAE1 | 5-167 | None |
| A0A2A2KNL3 | 2-142 | None |
| A2FIN1 | 277-490 | None |
| A0A5K3EXQ1 | 15-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.