DPCstruct | MC43546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 109 ± 14 aa |
| Standard deviation of domain lengths | 14.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A352ALA8 | 1-107 | MEYNEALALVNKAFLENHNRSLNDLETFVFQGAWQGQTYEQIAMERGYAAGTIARDVGFKFWKLLREALGEKASHTNFRTALERYRN… |
| K9SC35 | 23-111 | ESMTVQEALEIVDNLLKSNESRGLTDIQEVIFRHAWDGHSYLEIAHASGYDAGYIRDVGARLWRSLSLALGEKVSKNNFRAALRRYQ… |
| A0A351L329 | 1-106 | None |
| A0A563VSI1 | 70-177 | None |
| A0A2Z6UHQ9 | 46-131 | None |
| H1WDS5 | 1-82 | None |
| A0A7X6CJC3 | 5-126 | None |
| I4HYN0 | 39-152 | None |
| A0A6P0I7Y0 | 1-105 | None |
| A0A261KL18 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.