DPCstruct | MC43544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 138 ± 24 aa |
| Standard deviation of domain lengths | 23.82 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9PR68 | 11-125 | ALGYVHADVYLDEKFLDDSWESNWVASEHPGKELGKFVLTHGKFYNDPENDKGIQTSQDARFYALSRKFKPFSNKDKPLVVQFTVKH… |
| A0A0C9R546 | 5-121 | CILLPIVGLVAADPTVYFKEEFNDGDGWKSRWVESTKGDNLGKFVLSAGKFYGDAEKSKGLQTSEDARFYGISSKFEPFSNEGKTLV… |
| A0A3Q3XFJ5 | 8-107 | None |
| A0A194REH2 | 18-161 | None |
| A0A485NN69 | 397-552 | None |
| A0A0B2PP67 | 67-146 | None |
| A0A3P9HPN4 | 20-194 | None |
| A0A815FP38 | 42-177 | None |
| A0A7R9A5J0 | 174-347 | None |
| A0A7S0MDB0 | 23-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.