DPCstruct | MC43543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 112 ± 9 aa |
| Standard deviation of domain lengths | 8.62 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 69.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453E6T8 | 1-108 | GNGLAGGGGGRVSINVFSRHDDTQIFVHGGMSSGCPDNAGAAGTLYDAVPKSLDVNNNNMSTQTDTLLLDFPNQPLWTNVNIRNHAK… |
| A0A287F010 | 271-385 | GGSIYLKAATMQGGGKISACGGNGLSGGGGGRVSIDVFSRHDDTHFFVHGGRSSGCPGNAGAAGTLYEEVPKSITVSNNNLSTQTDT… |
| A0A446IQS4 | 6-105 | None |
| A0A453A9X6 | 1-89 | None |
| A0A287KCP5 | 135-253 | None |
| A0A1D6LZX3 | 275-389 | None |
| A0A453E6Z4 | 192-310 | None |
| A0A397Z4N3 | 221-336 | None |
| A0A804UFJ3 | 269-387 | None |
| A0A287F021 | 2-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.