DPCstruct | MC43540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 119 ± 11 aa |
| Standard deviation of domain lengths | 11.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453DZB0 | 1-111 | MTLHVFHRVCLACPWSLSAVRLQMAENNGQLPTHGNVLSLFVVADDSYDFPEEVSLRTEIEKHMVTRFSVLELHVETLGHVFGAFAF… |
| A0A3B6SU74 | 17-139 | VEKVSWHCCYRAGSVTFGLWELEQLTLETSESQGQLSSLQIHASIFRSNFPGGAINFMQEIAKHMVAAFSALELHLKTVGHVFGAIV… |
| A0A0A9UB57 | 50-166 | None |
| A0A4U6V7A2 | 1-121 | None |
| A0A1E5V7S5 | 274-380 | None |
| R7WB04 | 5-111 | None |
| A0A446SKB7 | 409-549 | None |
| M8BRZ8 | 307-425 | None |
| M7ZS26 | 16-125 | None |
| A0A453CZM5 | 103-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.