DPCstruct | MC43538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 8.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 45.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453DYF8 | 1-89 | DNKIESGWLQFYDLKHNVAVINIIRYHSLQVACLDHQRQIESQSKVVAVGRCFNSGKLMATAGMLTDNPRGAYREELAISTCEITMV… |
| A0A453DYE5 | 212-309 | KVADNLKIVVCLPDNRHTRGTLQHYSLHYNIAVVHIKNFCCTQTAQIDNQMLIKPQKEVVAIGRVYQSGKLMATSGIVTDKPSKLGC… |
| A0A0A9FE76 | 12-81 | None |
| A0A811PHK9 | 510-602 | None |
| A0A0D9V6F2 | 1-99 | None |
| A0A3B6EEK2 | 116-208 | None |
| A0A0E0I5B9 | 94-187 | None |
| A0A453J4U8 | 1-101 | None |
| A0A453J4V4 | 53-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.