DPCstruct | MC43535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 119 ± 8 aa |
| Standard deviation of domain lengths | 7.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 53.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453DWS2 | 2-121 | QALGQAIDVQLGLAIDSPKATLAAKRSLACEMVKCWQQAHESIADIPLLDGWGEKHRLFVKWKHMEAKAAAYYYHALILDKGNTEKS… |
| A0A287K674 | 3-134 | EAISIQSLAQCVEIQLGLASECEKATLSVKRRLACEQVSYFSKAHYCLSGCDTSDSYGKKLLLFLNWKCMDAKAVAYYYHALVLDKG… |
| A0A453S418 | 70-181 | None |
| A0A453S2U5 | 1-118 | None |
| A0A833RJ39 | 1-109 | None |
| A9SHC5 | 209-333 | None |
| A0A445FEG2 | 230-349 | None |
| A0A7J7LY91 | 273-392 | None |
| A0A833R6J5 | 9-122 | None |
| A0A446WFC3 | 106-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.