DPCstruct | MC43532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 112 ± 17 aa |
| Standard deviation of domain lengths | 17.41 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.76 |
| Pfam Score | 91.79 |
| Assigned Pfam label(s) | PF20451- PF20452 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453DTS6 | 12-115 | MMGDGMTDRMWEVTTSHARTCDAGDKVYAYAGQHGATVYVNSLCQLVRLEFAGVECAAQQLTRAQKAYVHQLYVEAFEQRHSLQEVE… |
| A0A287QPK7 | 207-297 | MSPAAWKAIIEHAMTCKVGDTLYMHEIKESNMEFFFDAILQLVGVKFGDCYKPLDMIHPAEKNLVETLKQKAYENMKDVQYDHIMIN… |
| A0A2G3ATF8 | 135-247 | None |
| Q852B6 | 50-152 | None |
| A0A5P1ESP7 | 529-653 | None |
| A0A287QP84 | 242-380 | None |
| A0A7J8LR12 | 6-120 | None |
| A0A835ENT3 | 359-447 | None |
| A0A022RS14 | 224-363 | None |
| A0A2T7F7Z1 | 190-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.