DPCstruct | MC43530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 92 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 65.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9IQ32 | 11-100 | LQSSGMLSGEQLFHLFNRFTSLTSLPDVKKRIAEAVEDKQEAVAVTTAIQEEIFLEMGVDPSFGLSCLGKVNMVYENDQELMIHFYK… |
| A0A453DQF0 | 6-95 | GGSMMTREQLLHLFSRFSFLTSLPEFKDRIADAVSDKQEAVAVTTEVQEEILREMGIDPGFGISCLGKVNVVYENDMDLMIKFYQFV… |
| A0A5E4FG34 | 3-95 | None |
| A0A835KMQ2 | 1-85 | None |
| A0A314YYQ1 | 3-95 | None |
| A0A3S3MPC3 | 82-181 | None |
| A0A2K1L9X1 | 12-109 | None |
| A0A445CTZ5 | 5-95 | None |
| A9SVY8 | 1-90 | None |
| A0A7G2ENS5 | 2-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.