DPCstruct | MC4353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 9.24 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.02 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | PF12660- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7VQM1 | 16-115 | EFDFSIAENCLSFVVNNLAQVEKCPICSEIILYCNPLSGSCSNNHCWERCVLTQCIVSQFAESMSCSICNKLVNITRGGWLGHVLKT… |
| A0A151MFR4 | 141-234 | VLIGHILKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLVYRRCLLHDSIARHPTPEDPEWIKRLLQGPCT… |
| A0A7G5JJL0 | 1028-1111 | None |
| H1V3W6 | 111-204 | None |
| A0A6J8DK04 | 505-600 | None |
| A0A0V0J7Z2 | 241-320 | None |
| T1F0Q6 | 53-143 | None |
| A0A1V8SKY6 | 605-703 | None |
| A0A0M8MTU0 | 783-858 | None |
| A0A5K3FFK2 | 443-540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.