DPCstruct | MC43526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 6.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 61.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453DB68 | 1-67 | MRPESQEGLSVSDWFNILVLHQNRIKTNPKSAINEHFLPRFLDFVVWGHEHECLIDPQEVPGMGFHI |
| E0VFW2 | 190-251 | TRPEVDPDSWFNILILHQNRVDRGPKRYISESYIPEFIDLLIWGHEHDCLIEPYKNVEKGFF |
| A0A2G3BID2 | 172-238 | None |
| A0A067RHP0 | 81-153 | None |
| A0A1U8EHY5 | 73-138 | None |
| A0A4S4EU81 | 112-177 | None |
| A0A653DN15 | 7-61 | None |
| A0A287JK72 | 68-133 | None |
| A0A287JK28 | 4-81 | None |
| A0A7R9HY19 | 75-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.