DPCstruct | MC43523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 8.03 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF02910- CL0536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q1RIW3 | 1-57 | MILPYKGIKPNINKIAYIAPSSSIIGDVKIGSNSSIWFNTVLRGDVESIKLLLFVII |
| A0A2V9TPW7 | 2-66 | LIEHEGSIPEIDSSAYVAPNATICGNVSIGRGTRIMFGACIVAEGAPITIGENCIVMESAVIRST |
| A0A812NG81 | 86-158 | None |
| A0A4S4F1K3 | 154-228 | None |
| A0A4C1ZDA8 | 43-135 | None |
| A0A6A5DCQ1 | 174-242 | None |
| A0A3S4JNR4 | 1-79 | None |
| A0A2V7WSL1 | 201-270 | None |
| A0A0K0ECA3 | 1-79 | None |
| A0A1I8I4N9 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.