DPCstruct | MC4352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 195 ± 37 aa |
| Standard deviation of domain lengths | 36.85 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.26 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0123- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q1BPV7 | 155-307 | CYCYCAGPGEWNLKMLQCGSCGQWFHEACTQCLTKPLLYGDRFYQFQCSVCTKGPETIQRLPMTWVDLAHLVLYHLSLCCKRKYFDF… |
| A0A1X7VQG2 | 1-212 | MASCGYCTQPFEDSSPWLPLLCRLCERYFHLDCLGSKRKPTALRGDQLFQFCCSFCSETRTETWSRLSLNWVHVIHLSLYNLMLSEG… |
| A0A3M0J490 | 75-265 | None |
| A0A7J8KCS8 | 2-156 | None |
| A0A2H9TFB0 | 1-148 | None |
| A0A1X7SYA4 | 2-165 | None |
| A0A504Z1B7 | 2-144 | None |
| G3WXM1 | 78-325 | None |
| A0A821XTE8 | 7-169 | None |
| A0A817PDT2 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.