DPCstruct | MC43519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Standard deviation of domain lengths | 6.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 95.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 42.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0IM08 | 1-80 | MNKGYTLQQTVDSVKLSESLANQPNLQEFYGSVPWGVRSIYLYYVGWYDDNPTNLYPLTSSQEAKNIITLAGVKIRFLKS |
| A0A370I2G5 | 59-148 | GYVGAEIAEELRLPPALTEKWFTHGYYGSVSHNVKAIYQRYMGWFDGNPAHLWEHPPVASAQRHATAMGGVDEVVRKTQTAYDAGDF… |
| A0A241W4S7 | 54-143 | None |
| A0A6G3VHU1 | 31-103 | None |
| R0B384 | 91-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.