DPCstruct | MC43512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 278 ± 42 aa |
| Standard deviation of domain lengths | 41.76 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14997 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8HSM0 | 11-277 | WLARVAFIVVLSTQAILLDSYLVVYLKKSSAHAYIVTYIPAVILWIRGQISNKGRTVAAAVWFLYILPLAGIIGWIFDQLLQKIDKN… |
| A0A7J7K175 | 2-212 | KNGLPLACVTWFIYSAFVAAKVAVIFKSGIPDRLLESDFYGPQFLKTGICLSGVVFILFAGSQHHAKEGVKERLYINSMASGVTFDV… |
| A0A3Q0IK73 | 43-317 | None |
| A0A3M6UM71 | 9-235 | None |
| A0A3M6UM09 | 268-522 | None |
| A0A2B4QZU8 | 23-253 | None |
| A0A6P8IP55 | 6-299 | None |
| A0A1D3RD26 | 1-322 | None |
| K7F1Z0 | 4-267 | None |
| A0A4Y2USV8 | 26-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.