DPCstruct | MC4351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Standard deviation of domain lengths | 8.25 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15000 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3DB35 | 1-92 | MIQPKMERNSHWREVEVFQVARSFVLTRRSSMYFDEDGDLAHEFYEETVVTKNGQRKAKLKRIYKNLTPQGIIKLDHPCIHVDFPVV… |
| A0A1X7VPV3 | 3-103 | GLLSGKKEDDKSGGEGERGKNAVVRPPFKCNPYVLKRTSSQYFDEDGDLAHSFYEECRVIPGEGPIRRTMRLLSHNGIRPQGEVALC… |
| K1R7M3 | 1-106 | None |
| A0A6I8PP39 | 10-113 | None |
| A0A2P8Z048 | 1-106 | None |
| A0A4V5PAF5 | 24-138 | None |
| A0A402FAV2 | 440-529 | None |
| A0A3Q0DN20 | 10-111 | None |
| A0A6G0J4Q5 | 373-465 | None |
| A0A4X2LMP2 | 65-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.