DPCstruct | MC43509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 201 ± 33 aa |
| Standard deviation of domain lengths | 33.48 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 25.29 |
| Pfam Score | 97.67 |
| Assigned Pfam label(s) | CL0286- CL0164- PF16977 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A5GCS7 | 239-444 | GPYDVGVIPRRPWACPPGSEYIEFYTDDEDSRNDNYTWGWVGATRQNNAGTRLGFCRVDGTRFTNLVDVWNRDLAMATYSVLRLGSR… |
| A0A6P8HBL1 | 25-189 | ILDSARWLAGTYALLKPKAGCPTGWEKEGRIEQYTGLNDDNSNALHIQGEVSQDKIIRNFCIKKIHDNTIYQSWPTGKYCIYGKPYA… |
| A0A3S1BIR1 | 214-440 | None |
| A0A3S1B6F9 | 154-345 | None |
| A0A3S0ZP39 | 101-321 | None |
| A0A6P8HTZ7 | 1-159 | None |
| A0A2C9K841 | 92-294 | None |
| A0A0C2MPY7 | 15-233 | None |
| Q6ITV5 | 77-288 | None |
| A0A1D1W643 | 95-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.