DPCstruct | MC43505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 47.57 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0020- PF15443 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8H1I8 | 1-74 | MKTHLTSAAGILALLEEGESDLKVYALDKLNVIMDDFWAEISESVAKIEVLYEDETFKHRKLSALVASKVRRKI |
| A0A086M9F3 | 25-99 | APPASSAAGVLALLHERDSALQAASLHRLLQMIDVWWTEIADYLADIEALYEDESFAERQLAGFIASRVYFHLEE |
| A0A183MXF4 | 1-86 | None |
| A0A086Q4Y7 | 24-93 | None |
| A0A0V1Q0K8 | 1-72 | None |
| A0A6G3MJ61 | 5-82 | None |
| A0A1S8VI56 | 1-83 | None |
| A0A446J957 | 1-79 | None |
| A0A5B7D2B2 | 1-76 | None |
| A0A1Y3ECS7 | 458-524 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.