DPCstruct | MC43500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 91 ± 11 aa |
| Standard deviation of domain lengths | 11.11 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5TCR1 | 1-77 | MLPPGLEAPRAADYVAAATALWDSWADGLHRVDRASGRYVDTAGIRPPLHQGPFYRTAGPMDIPRPPQGHPVRYAAA |
| A0A0M8PA17 | 44-126 | VTSWKESAAKAVGLLLVDHDKRYEIADEYLTSLYKLWEGSWADDALQENAETGVYADPSRINYTHHHGEHFKFDGPHILDPSP |
| A0A084RSA2 | 140-240 | None |
| A0A851HPT0 | 97-182 | None |
| R8BXR7 | 303-403 | None |
| R8BCS6 | 3-97 | None |
| A0A3P8M0I9 | 2-86 | None |
| A0A2X3E2X6 | 16-97 | None |
| K0I3J0 | 187-281 | None |
| A0A5M3VWZ2 | 61-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.