DPCstruct | MC435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Standard deviation of domain lengths | 7.79 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521S1S1 | 3-90 | EKGESKVTVDPEEIRRWAEARGGKPAVVKGTDILRINFPGGAEEELQDIPWEEFFQKFEEKGLAFLYQEKKADGEPSTFNKFVSRETV |
| A0A7C2ZAN4 | 17-109 | GCRPGETLATRELAVIQRWAAERGAVPATVPGTEHEGRPGVLALDFPGFKEKGLQPISWEEWFKTFQVRHLWFLYQERLRDGRPSNF… |
| A0A285F1T3 | 156-248 | None |
| A0A848PXB1 | 3-96 | None |
| U4V8F3 | 36-140 | None |
| A0A0G1MN52 | 2-101 | None |
| A0A522T5J6 | 2-88 | None |
| Q2IPC2 | 5-96 | None |
| A0A3L7BV85 | 292-388 | None |
| A0A143PK42 | 34-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.