DPCstruct | MC43495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 211 ± 37 aa |
| Standard deviation of domain lengths | 36.82 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D3CG35 | 44-271 | FNTPGFYIPGYTYTDYQNAFFYTFFRRPFTHSWFIQFQFNCPKLIPNWFYEWWYYFGPVDQIYPEPILKTSLPYYQKQTPQPSTPIM… |
| A0A151R5E0 | 314-556 | MESEFWDKNPNKISQKIFPEGFHFKPLALNKTRKFYEFILVDTDSVAIKHYKDPKDPSNVTHTTFQILKVLTPSQFGQNPSTTQKFS… |
| K7MC34 | 1163-1352 | None |
| H2KWE4 | 264-509 | None |
| A0A0D2R2C2 | 128-321 | None |
| M1DWK7 | 50-329 | None |
| A0A1U8EKG5 | 179-413 | None |
| A0A1J6JNS3 | 6-183 | None |
| A0A834XCF5 | 9-146 | None |
| A0A1Q3DK47 | 10-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.