DPCstruct | MC4349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 97 ± 17 aa |
| Standard deviation of domain lengths | 16.68 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8USN8 | 120-191 | TDVSLADAMIGKAVEHMFETEEGPKEEWRGMVLARAPIMTTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPD |
| A0A1X7VL36 | 1-100 | MQKTSITFTSNGRKRSLSILIEEVKKLIADSTVICDPNSLVGKSVMHKFLVDNEREEWFSGFVLDYDGETHHIKYEDSSEIFNFNLI… |
| R7TD85 | 276-372 | None |
| A0A6F9AFL6 | 184-292 | None |
| A0A6F8ZZY9 | 35-108 | None |
| A0A8B6HJ14 | 173-279 | None |
| A0A8B6HHS2 | 289-398 | None |
| F1LUT3 | 197-267 | None |
| A0A8B6F0L1 | 227-314 | None |
| V4AN69 | 70-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.