DPCstruct | MC4348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 107 ± 6 aa |
| Standard deviation of domain lengths | 5.54 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A432PVR6 | 1-108 | MSETYNWFARSSSRQKAYNNLFKLINDGHEPLKIVQACQTRWLSIASAVQRLCDQWLELKTHFSLTRTSEKCYNSEMLHAMYSDEFN… |
| A0A1X7VJS6 | 1-118 | MSVTLHIFVLQMHVKSYHMLLRIFSKRLALKQSQHFTSTEPHKILKPAQTRCLSLHQCVVRVLEQWSALGAYFKQAAQKERLIATQN… |
| J9LNY8 | 73-175 | None |
| A0A6S7JDA2 | 3-103 | None |
| J9M6X3 | 67-170 | None |
| A0A6G0WBY2 | 230-332 | None |
| A0A6G0VVH4 | 15-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.