DPCstruct | MC43478
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 106 ± 5 aa |
| Standard deviation of domain lengths | 4.73 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 31.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4TQF4 | 21-124 | DLICHYGTGRVIHIDGRGASKQIQYRFGIQTEIGDFEVHEWMKLVRVLIERAGEEPLQQRLVELLEQEMPWLHRDFERQLEALELHA… |
| A0A373B317 | 2-105 | VEDYKIKQNIFIVVETGEYIVSRNGRRVKNRIGVKYYDTYKFGRLTHDKWIQLVLIEVERDGKRDLLEWIKNHCSKHCVWLKTEADI… |
| A0A3R8LEJ3 | 1-118 | None |
| A0A2P2BRG7 | 3-109 | None |
| A0A174LS86 | 4-106 | None |
| A0A212IW79 | 27-136 | None |
| A0A6L9HIL7 | 11-112 | None |
| A0A413JGM0 | 21-124 | None |
| A0A7U9RIV9 | 160-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.