DPCstruct | MC43472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 169 ± 22 aa |
| Standard deviation of domain lengths | 22.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N3WBE7 | 2-152 | VVETEKCSISMKMASPEDVSEVLAHIGTNLRKIFPGLSPLRIMKKVFMEPSERLASLQALWDSQTVAEQGPCGGFSQMYACVCDWLG… |
| A0A1J4JWR7 | 65-237 | CALSMHYVGIFFQKHPGKVKKIAFFNIFCITKFVLSYVNRRQQLLLETETTDVRLLSGPVLTTARLIYRNYSFATFPLPQSLKTTFH… |
| F6NI44 | 59-229 | None |
| A0A0N0PCZ5 | 64-228 | None |
| A0A2K6RE30 | 1-144 | None |
| A0A2I4BDA6 | 252-418 | None |
| A0A2P6NQJ7 | 56-244 | None |
| D3BMV0 | 339-513 | None |
| A2DD96 | 18-173 | None |
| A0A139WLP5 | 4-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.