DPCstruct | MC4347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 123 ± 18 aa |
| Standard deviation of domain lengths | 18.08 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 64.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11261 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I0ZBY7 | 3-118 | VMQKRQHCYLCDLPRMPWAMLHDFSEAVCRGCVNYEGADRIEVVLETARQLKRAHGFQEGRAPTHVKGAHRASMEPHQNGGESNARG… |
| A0A6P4U400 | 4-98 | VQASRRQWCYLCDLPKMPWAMVWDFSEAVCRGCVNFEGADRIELLIDAARQLKRSHVLPEGRSPGPPALKHPTTKDLAAAAAQGPQL… |
| A0A6I8PGC4 | 277-389 | None |
| A0A182FAZ3 | 2-125 | None |
| A0A669D5F1 | 10-122 | None |
| A0A5J4P347 | 19-119 | None |
| A0A6A4WA49 | 1-129 | None |
| A0A183TZD3 | 16-149 | None |
| A0A6F9DFJ0 | 1-107 | None |
| A0A0B1TDJ7 | 5-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.