DPCstruct | MC43461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 90 ± 13 aa |
| Standard deviation of domain lengths | 12.97 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7DYY0 | 127-217 | KLLTIENLDSRAVGPIYEAVKDWEEPVAIAVLPDHPTPCELRTHTNEPIPFLIWYPGIEPDSVQTFDEASVCEGSYGLLKEDEFINE… |
| A0A1V5YMG2 | 15-92 | IVGPFLEYQAAHPETRLLAAPDHFTLISTKTHAGGPVPFAMCGPGIERDEVASYSEKAAAAGGILVARGHELLHHFIH |
| A0A7Z0LWD8 | 79-167 | None |
| A0A7V0Q8I3 | 1-78 | None |
| A0A843HC71 | 97-181 | None |
| A0A2A4M240 | 84-181 | None |
| A0A7J3XVQ6 | 290-372 | None |
| A0A645IPT7 | 2-81 | None |
| A0A7V2YZQ3 | 250-346 | None |
| X1L7E3 | 171-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.