DPCstruct | MC43460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 5.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 56.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5YJM5 | 2-66 | PLPHPADTNEDFRMVLGEAIAYLAGWQQGSNPIAYAIRAAYLWQNGEAYTYVSEIAPPLCWVLEN |
| A0A1V5YHS1 | 32-104 | EDAVEGEQQLPHAADLNADWRLDISETIAYLFGWQQGGNSIAWAIRAAYLWQNGERYTYDELQAPPLCWTLTP |
| A0A1V6E438 | 171-245 | None |
| A0A1V6EEB7 | 286-355 | None |
| A0A1V6EPE5 | 30-101 | None |
| A0A1V6ERU6 | 67-132 | None |
| A0A1V6ESQ3 | 427-496 | None |
| A0A1V6EVE1 | 127-211 | None |
| A0A1V6EXT0 | 23-96 | None |
| A0A1V6F0E8 | 996-1067 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.