DPCstruct | MC43459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 210 ± 19 aa |
| Standard deviation of domain lengths | 19.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06055 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S3L0A9 | 1-215 | MTAVDRLTGVLEEFVEKARLERVMLGDMLAAIGDGGYGFICLLISLPFLIPVSLGPISTAAGAAFLILGWQMIRGRQSPWLPQRIAA… |
| A0A1X7PGP8 | 1-218 | MDEHEQQALPGTPRRPQPARLSSLFERLAAEGDGPITVAEIRTALGDRSLATLLIFFAVINLIPLPPPSSAILGLPLLIVAAQMLYG… |
| A0A7X7YFL5 | 2-184 | None |
| A0A0C6EYD5 | 77-289 | None |
| A0A520CKZ0 | 166-367 | None |
| A0A6B8M4Z8 | 50-254 | None |
| L1JJ49 | 133-327 | None |
| A0A7W7N627 | 2-258 | None |
| A0A350EQA9 | 27-246 | None |
| A0A351ME61 | 196-391 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.