DPCstruct | MC43458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 136 ± 12 aa |
| Standard deviation of domain lengths | 11.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7MSY7 | 116-261 | WLAEHLPARLPVDPSAGVPNESTRVYRLQTDAGERIIGRKVSPASAANATTTGATALTPDEAFIALMDGRTILDLSEGLQLRRTRVM… |
| A0A1Q4CW10 | 3-122 | IYRLQTEDGERAIGRLVSQEQLLNVYARLGLDCQIEMTPQEVFGAVMDAKTTLSLLGGYQLRRSLVMGQPRLELNSASGTALPALKA… |
| A0A7W5XX59 | 54-166 | None |
| A0A4R2SCD5 | 817-952 | None |
| A0A3E1B1A9 | 144-260 | None |
| A0A7Z8FVV2 | 148-286 | None |
| A0A4P7ZDX0 | 333-459 | None |
| A0A7W1ZY19 | 35-163 | None |
| A0A6P1BB88 | 43-191 | None |
| A0A7X4ENQ5 | 229-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.