DPCstruct | MC43453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 166 ± 21 aa |
| Standard deviation of domain lengths | 21.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 59.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3R7J7 | 2-130 | LPKRKRLADYYPLTPEDAVILQRMSSRSFNIYFINQLLLKLSNKYPNRHFVNKIAVLNYMAKALANELLTTEQANSGNFRFNDVGRF… |
| A0A0F3RBW3 | 17-170 | VSSANNDSAVGSRKHKGWFKRKKLADFYPLSQEDADLLRVKSNREFNLDFINKLLLKLAGEYSNHHFGHKKVLLNYMAKALAHELRE… |
| A0A4Q3DH56 | 2-137 | None |
| A0A2B4R183 | 216-414 | None |
| B3CUZ3 | 74-243 | None |
| A0A2U3RPD0 | 79-247 | None |
| A0A2U3R473 | 1-170 | None |
| A0A0F3RP73 | 30-199 | None |
| A0A0F3RNM5 | 30-199 | None |
| A0A0F3RI28 | 1-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.